SCOP 1.71: Domain d1pd0a2: 1pd0 A:133-215,A:553-646

Lineage for d1pd0a2 (1pd0 A:133-215,A:553-646)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.8: beta-sandwich domain of Sec23/24 [81995] (1 family)

5. Family b.2.8.1: beta-sandwich domain of Sec23/24 [81996] (2 proteins)

6. Protein Sec24 [81999] (1 species)
   includes the N-terminal tail

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82000] (4 PDB entries)

8. Domain d1pd0a2: 1pd0 A:133-215,A:553-646 [94503]
   Other proteins in same PDB: d1pd0a1, d1pd0a3, d1pd0a4, d1pd0a5
   complexed with a snare peptide
   complexed with zn

Details for d1pd0a2

PDB Entry: 1pd0, 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Sed5 (yeast syntaxin-5)

SCOP Domain Sequences for d1pd0a2:

Sequence; same for both SEQRES and ATOM records:

>d1pd0a2 b.2.8.1 (A:133-215,A:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
rpmnqlypidlltelpppitdltlpppplvippermlvpselsnaspdyirstlnavpkn
ssllkksklpfglvirpyqhlydXcmetvmrargstglrmsrfyghffnrssdlcafstm
prdqsylfevnvdesimadycyvqvavllslnnsqrririitlamptteslaevyasa

Timeline for d1pd0a2:

• d1pd0a2 first appeared in SCOP 1.67
  
• d1pd0a2 appears in SCOP 1.69
  
• d1pd0a2 appears in SCOP 1.73
  
• d1pd0a2 appears in the current release, SCOPe 2.08