SCOPe 2.06: Domain d1pd0a1: 1pd0 A:647-753

Lineage for d1pd0a1 (1pd0 A:647-753)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
   5 helices; bundle

4. Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family)
   automatically mapped to Pfam PF04815

5. Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins)

6. Protein Sec24 [81815] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81816] (4 PDB entries)

8. Domain d1pd0a1: 1pd0 A:647-753 [94502]
   Other proteins in same PDB: d1pd0a2, d1pd0a3, d1pd0a4, d1pd0a5
   complexed with a snare peptide
   complexed with zn

Details for d1pd0a1

PDB Entry: 1pd0, 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Sed5 (yeast syntaxin-5)

PDB Compounds: (A:) protein transport protein SEC24

SCOPe Domain Sequences for d1pd0a1:

Sequence, based on SEQRES records:

>d1pd0a1 a.71.2.1 (A:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivvsntaggaplrlcan
lrmfpllmhsltkhmafrsgivpsdhrasalnnleslplkylikniy

Sequence, based on observed residues (ATOM records):

>d1pd0a1 a.71.2.1 (A:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivggaplrlcanlrmfp
llmhsltkhmafrsgivpsdhrasalnnleslplkylikniy

Timeline for d1pd0a1:

• d1pd0a1 first appeared in SCOP 1.67
  
• d1pd0a1 appears in SCOPe 2.05
  
• d1pd0a1 appears in SCOPe 2.07
  
• d1pd0a1 appears in the current release, SCOPe 2.08