Lineage for d1pd0a1 (1pd0 A:647-753)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445145Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 445155Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family) (S)
  5. 445156Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins)
  6. 445162Protein Sec24 [81815] (1 species)
  7. 445163Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81816] (4 PDB entries)
  8. 445167Domain d1pd0a1: 1pd0 A:647-753 [94502]
    Other proteins in same PDB: d1pd0a2, d1pd0a3, d1pd0a4, d1pd0a5
    complexed with a snare peptide

Details for d1pd0a1

PDB Entry: 1pd0 (more details), 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Sed5 (yeast syntaxin-5)

SCOP Domain Sequences for d1pd0a1:

Sequence, based on SEQRES records: (download)

>d1pd0a1 a.71.2.1 (A:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivvsntaggaplrlcan
lrmfpllmhsltkhmafrsgivpsdhrasalnnleslplkylikniy

Sequence, based on observed residues (ATOM records): (download)

>d1pd0a1 a.71.2.1 (A:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivggaplrlcanlrmfp
llmhsltkhmafrsgivpsdhrasalnnleslplkylikniy

SCOP Domain Coordinates for d1pd0a1:

Click to download the PDB-style file with coordinates for d1pd0a1.
(The format of our PDB-style files is described here.)

Timeline for d1pd0a1: