| Class g: Small proteins [56992] (79 folds) |
| Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) ![]() |
| Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins) |
| Protein Sec24 [82923] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82924] (4 PDB entries) |
| Domain d1pcxa5: 1pcx A:216-300 [94501] Other proteins in same PDB: d1pcxa1, d1pcxa2, d1pcxa3, d1pcxa4 complexed with a snare peptide complexed with zn |
PDB Entry: 1pcx (more details), 2.5 Å
SCOP Domain Sequences for d1pcxa5:
Sequence, based on SEQRES records: (download)
>d1pcxa5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqsdpndpk
srydrneikcavmeymapkeytlrq
>d1pcxa5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqpksrydr
neikcavmeymapkeytlrq
Timeline for d1pcxa5:
View in 3DDomains from same chain: (mouse over for more information) d1pcxa1, d1pcxa2, d1pcxa3, d1pcxa4 |