SCOPe 2.08: Domain d1pcxa5: 1pcx A:216-300

Lineage for d1pcxa5 (1pcx A:216-300)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family)

5. Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins)

6. Protein Sec24 [82923] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82924] (4 PDB entries)

8. Domain d1pcxa5: 1pcx A:216-300 [94501]
   Other proteins in same PDB: d1pcxa1, d1pcxa2, d1pcxa3, d1pcxa4
   complexed with a snare peptide
   complexed with zn

Details for d1pcxa5

PDB Entry: 1pcx, 2.5 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Bet1

PDB Compounds: (A:) protein transport protein SEC24

SCOPe Domain Sequences for d1pcxa5:

Sequence, based on SEQRES records:

>d1pcxa5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqsdpndpk
srydrneikcavmeymapkeytlrq

Sequence, based on observed residues (ATOM records):

>d1pcxa5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqpksrydr
neikcavmeymapkeytlrq

Timeline for d1pcxa5:

• d1pcxa5 first appeared in SCOP 1.67
  
• d1pcxa5 appears in SCOPe 2.07