Lineage for d1pcxa5 (1pcx A:216-300)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037307Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) (S)
  5. 3037308Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins)
  6. 3037315Protein Sec24 [82923] (1 species)
  7. 3037316Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82924] (4 PDB entries)
  8. 3037319Domain d1pcxa5: 1pcx A:216-300 [94501]
    Other proteins in same PDB: d1pcxa1, d1pcxa2, d1pcxa3, d1pcxa4
    complexed with a snare peptide
    complexed with zn

Details for d1pcxa5

PDB Entry: 1pcx (more details), 2.5 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Bet1
PDB Compounds: (A:) protein transport protein SEC24

SCOPe Domain Sequences for d1pcxa5:

Sequence, based on SEQRES records: (download)

>d1pcxa5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqsdpndpk
srydrneikcavmeymapkeytlrq

Sequence, based on observed residues (ATOM records): (download)

>d1pcxa5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqpksrydr
neikcavmeymapkeytlrq

SCOPe Domain Coordinates for d1pcxa5:

Click to download the PDB-style file with coordinates for d1pcxa5.
(The format of our PDB-style files is described here.)

Timeline for d1pcxa5: