Lineage for d1pcxa4 (1pcx A:754-926)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509537Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 509651Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) (S)
  5. 509652Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins)
  6. 509658Protein Sec24 [82758] (1 species)
  7. 509659Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82759] (4 PDB entries)
  8. 509661Domain d1pcxa4: 1pcx A:754-926 [94500]
    Other proteins in same PDB: d1pcxa1, d1pcxa2, d1pcxa3, d1pcxa5
    complexed with a snare peptide

Details for d1pcxa4

PDB Entry: 1pcx (more details), 2.5 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Bet1

SCOP Domain Sequences for d1pcxa4:

Sequence, based on SEQRES records: (download)

>d1pcxa4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
pdvyslhdmadeaglpvqtedgeatgtivlpqpinatsslferyglylidngnelflwmg
gdavpalvfdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyi
vrgaslsepvnhasarevatlrlwasstlvedkilnnesyreflqimkarisk

Sequence, based on observed residues (ATOM records): (download)

>d1pcxa4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
pdvyslhdmadeaglpvgtivlpqpinatsslferyglylidngnelflwmggdavpalv
fdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyivrgaslse
pvnhasarevatlrlwasstlvedkilnnesyreflqimkarisk

SCOP Domain Coordinates for d1pcxa4:

Click to download the PDB-style file with coordinates for d1pcxa4.
(The format of our PDB-style files is described here.)

Timeline for d1pcxa4: