![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) ![]() |
![]() | Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins) |
![]() | Protein Sec24 [82758] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82759] (4 PDB entries) |
![]() | Domain d1pcxa4: 1pcx A:754-926 [94500] Other proteins in same PDB: d1pcxa1, d1pcxa2, d1pcxa3, d1pcxa5 complexed with a snare peptide complexed with zn |
PDB Entry: 1pcx (more details), 2.5 Å
SCOPe Domain Sequences for d1pcxa4:
Sequence, based on SEQRES records: (download)
>d1pcxa4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pdvyslhdmadeaglpvqtedgeatgtivlpqpinatsslferyglylidngnelflwmg gdavpalvfdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyi vrgaslsepvnhasarevatlrlwasstlvedkilnnesyreflqimkarisk
>d1pcxa4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pdvyslhdmadeaglpvgtivlpqpinatsslferyglylidngnelflwmggdavpalv fdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyivrgaslse pvnhasarevatlrlwasstlvedkilnnesyreflqimkarisk
Timeline for d1pcxa4:
![]() Domains from same chain: (mouse over for more information) d1pcxa1, d1pcxa2, d1pcxa3, d1pcxa5 |