Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (4 families) |
Family c.62.1.2: Trunk domain of Sec23/24 [82458] (2 proteins) |
Protein Sec24 [82461] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82462] (4 PDB entries) |
Domain d1pcxa3: 1pcx A:301-552 [94499] Other proteins in same PDB: d1pcxa1, d1pcxa2, d1pcxa4, d1pcxa5 complexed with a snare peptide complexed with zn |
PDB Entry: 1pcx (more details), 2.5 Å
SCOP Domain Sequences for d1pcxa3:
Sequence, based on SEQRES records: (download)
>d1pcxa3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae)} pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip ldsenneesadqinmmdiadleepflprpnsmvvslkacrqnietlltkipqifqsnlit nfalgpalksayhliggvggkiivvsgtlpnlgigklqrrnesgvvntsketaqllscqd sfyknftidcskvqitvdlflasedymdvaslsnlsrftagqthfypgfsgknpndivkf stefakhismdf
>d1pcxa3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae)} pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip ldseninmmdiadleepnsmvvslkacrqnietlltkipqifqsnlitnfalgpalksay hliggvggkiivvsgtlpnlgigklqrdsfyknftidcskvqitvdlflasedymdvasl snlsrftagqthfypgfsgknpndivkfstefakhismdf
Timeline for d1pcxa3:
View in 3D Domains from same chain: (mouse over for more information) d1pcxa1, d1pcxa2, d1pcxa4, d1pcxa5 |