Lineage for d1pcxa2 (1pcx A:133-215,A:553-646)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552572Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 552971Superfamily b.2.8: beta-sandwich domain of Sec23/24 [81995] (1 family) (S)
  5. 552972Family b.2.8.1: beta-sandwich domain of Sec23/24 [81996] (2 proteins)
  6. 552978Protein Sec24 [81999] (1 species)
    includes the N-terminal tail
  7. 552979Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82000] (4 PDB entries)
  8. 552982Domain d1pcxa2: 1pcx A:133-215,A:553-646 [94498]
    Other proteins in same PDB: d1pcxa1, d1pcxa3, d1pcxa4, d1pcxa5
    complexed with a snare peptide
    complexed with zn

Details for d1pcxa2

PDB Entry: 1pcx (more details), 2.5 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Bet1

SCOP Domain Sequences for d1pcxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcxa2 b.2.8.1 (A:133-215,A:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
rpmnqlypidlltelpppitdltlpppplvippermlvpselsnaspdyirstlnavpkn
ssllkksklpfglvirpyqhlydXcmetvmrargstglrmsrfyghffnrssdlcafstm
prdqsylfevnvdesimadycyvqvavllslnnsqrririitlamptteslaevyasa

SCOP Domain Coordinates for d1pcxa2:

Click to download the PDB-style file with coordinates for d1pcxa2.
(The format of our PDB-style files is described here.)

Timeline for d1pcxa2: