SCOPe 2.08: Domain d1pcxa2: 1pcx A:133-215,A:553-646

Lineage for d1pcxa2 (1pcx A:133-215,A:553-646)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.8: beta-sandwich domain of Sec23/24 [81995] (1 family)

5. Family b.2.8.1: beta-sandwich domain of Sec23/24 [81996] (2 proteins)

6. Protein Sec24 [81999] (1 species)
   includes the N-terminal tail

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82000] (4 PDB entries)

8. Domain d1pcxa2: 1pcx A:133-215,A:553-646 [94498]
   Other proteins in same PDB: d1pcxa1, d1pcxa3, d1pcxa4, d1pcxa5
   complexed with a snare peptide
   complexed with zn
   has additional insertions and/or extensions that are not grouped together

Details for d1pcxa2

PDB Entry: 1pcx, 2.5 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Bet1

PDB Compounds: (A:) protein transport protein SEC24

SCOPe Domain Sequences for d1pcxa2:

Sequence; same for both SEQRES and ATOM records:

>d1pcxa2 b.2.8.1 (A:133-215,A:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rpmnqlypidlltelpppitdltlpppplvippermlvpselsnaspdyirstlnavpkn
ssllkksklpfglvirpyqhlydXcmetvmrargstglrmsrfyghffnrssdlcafstm
prdqsylfevnvdesimadycyvqvavllslnnsqrririitlamptteslaevyasa

Timeline for d1pcxa2:

• d1pcxa2 first appeared in SCOP 1.67
  
• d1pcxa2 appears in SCOPe 2.07