SCOP 1.71: Domain d1pcxa1: 1pcx A:647-753

Lineage for d1pcxa1 (1pcx A:647-753)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
   5 helices; bundle

4. Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family)

5. Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins)

6. Protein Sec24 [81815] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81816] (4 PDB entries)

8. Domain d1pcxa1: 1pcx A:647-753 [94497]
   Other proteins in same PDB: d1pcxa2, d1pcxa3, d1pcxa4, d1pcxa5
   complexed with a snare peptide
   complexed with zn

Details for d1pcxa1

PDB Entry: 1pcx, 2.5 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Bet1

SCOP Domain Sequences for d1pcxa1:

Sequence, based on SEQRES records:

>d1pcxa1 a.71.2.1 (A:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivvsntaggaplrlcan
lrmfpllmhsltkhmafrsgivpsdhrasalnnleslplkylikniy

Sequence, based on observed residues (ATOM records):

>d1pcxa1 a.71.2.1 (A:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivaggaplrlcanlrmf
pllmhsltkhmafrsgivpsdhrasalnnleslplkylikniy

Timeline for d1pcxa1:

• d1pcxa1 first appeared in SCOP 1.67
  
• d1pcxa1 appears in SCOP 1.69
  
• d1pcxa1 appears in SCOP 1.73
  
• d1pcxa1 appears in the current release, SCOPe 2.08