Class a: All alpha proteins [46456] (226 folds) |
Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family) |
Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins) |
Protein Sec24 [81815] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81816] (4 PDB entries) |
Domain d1pcxa1: 1pcx A:647-753 [94497] Other proteins in same PDB: d1pcxa2, d1pcxa3, d1pcxa4, d1pcxa5 complexed with a snare peptide complexed with zn |
PDB Entry: 1pcx (more details), 2.5 Å
SCOP Domain Sequences for d1pcxa1:
Sequence, based on SEQRES records: (download)
>d1pcxa1 a.71.2.1 (A:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae)} dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivvsntaggaplrlcan lrmfpllmhsltkhmafrsgivpsdhrasalnnleslplkylikniy
>d1pcxa1 a.71.2.1 (A:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae)} dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivaggaplrlcanlrmf pllmhsltkhmafrsgivpsdhrasalnnleslplkylikniy
Timeline for d1pcxa1:
View in 3D Domains from same chain: (mouse over for more information) d1pcxa2, d1pcxa3, d1pcxa4, d1pcxa5 |