SCOPe 2.06: Domain d1pcva_: 1pcv A:

Lineage for d1pcva_ (1pcv A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
   automatically mapped to Pfam PF00314

6. Protein Osmotin [101620] (1 species)
   antifungal protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [101621] (1 PDB entry)

8. Domain d1pcva_: 1pcv A: [94493]

Details for d1pcva_

PDB Entry: 1pcv, 2.3 Å

PDB Description: Crystal structure of osmotin, a plant antifungal protein

PDB Compounds: (A:) osmotin

SCOPe Domain Sequences for d1pcva_:

Sequence; same for both SEQRES and ATOM records:

>d1pcva_ b.25.1.1 (A:) Osmotin {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
atievrnncpytvwaastpigggrrldrgqtwvinaprgtkmarvwgrtncnfnaagrgt
cqtgdcggvlqctgwgkppntlaeyaldqfsgldfwdislvdgfnipmtfaptnpsggkc
haihctaningecprelrvpggcnnpcttfggqqycctqgpcgptffskffkqrcpdays
ypqddptstftcpggstnyrvifcp

Timeline for d1pcva_:

• d1pcva_ first appeared in SCOP 1.67
  
• d1pcva_ appears in SCOPe 2.05
  
• d1pcva_ appears in SCOPe 2.07
  
• d1pcva_ appears in the current release, SCOPe 2.08