Lineage for d1pcqg1 (1pcq G:2-136,G:410-525)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360967Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 360968Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 360969Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 360970Protein GroEL, E domain [48594] (2 species)
  7. 360971Species Escherichia coli [TaxId:562] [48595] (9 PDB entries)
  8. 361041Domain d1pcqg1: 1pcq G:2-136,G:410-525 [94462]
    Other proteins in same PDB: d1pcqa2, d1pcqa3, d1pcqb2, d1pcqb3, d1pcqc2, d1pcqc3, d1pcqd2, d1pcqd3, d1pcqe2, d1pcqe3, d1pcqf2, d1pcqf3, d1pcqg2, d1pcqg3, d1pcqh2, d1pcqh3, d1pcqi2, d1pcqi3, d1pcqj2, d1pcqj3, d1pcqk2, d1pcqk3, d1pcql2, d1pcql3, d1pcqm2, d1pcqm3, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_

Details for d1pcqg1

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES

SCOP Domain Sequences for d1pcqg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqg1 a.129.1.1 (G:2-136,G:410-525) GroEL, E domain {Escherichia coli}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOP Domain Coordinates for d1pcqg1:

Click to download the PDB-style file with coordinates for d1pcqg1.
(The format of our PDB-style files is described here.)

Timeline for d1pcqg1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqa1, d1pcqa2, d1pcqa3, d1pcqb1, d1pcqb2, d1pcqb3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqe1, d1pcqe2, d1pcqe3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcqk1, d1pcqk2, d1pcqk3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_