Lineage for d1pcqe3 (1pcq E:137-190,E:367-409)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411723Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 411724Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 411725Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 411726Protein GroEL, I domain [54851] (2 species)
  7. 411727Species Escherichia coli [TaxId:562] [54852] (9 PDB entries)
  8. 411795Domain d1pcqe3: 1pcq E:137-190,E:367-409 [94458]
    Other proteins in same PDB: d1pcqa1, d1pcqa2, d1pcqb1, d1pcqb2, d1pcqc1, d1pcqc2, d1pcqd1, d1pcqd2, d1pcqe1, d1pcqe2, d1pcqf1, d1pcqf2, d1pcqg1, d1pcqg2, d1pcqh1, d1pcqh2, d1pcqi1, d1pcqi2, d1pcqj1, d1pcqj2, d1pcqk1, d1pcqk2, d1pcql1, d1pcql2, d1pcqm1, d1pcqm2, d1pcqn1, d1pcqn2, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_

Details for d1pcqe3

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES

SCOP Domain Sequences for d1pcqe3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqe3 d.56.1.1 (E:137-190,E:367-409) GroEL, I domain {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1pcqe3:

Click to download the PDB-style file with coordinates for d1pcqe3.
(The format of our PDB-style files is described here.)

Timeline for d1pcqe3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqa1, d1pcqa2, d1pcqa3, d1pcqb1, d1pcqb2, d1pcqb3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcqk1, d1pcqk2, d1pcqk3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_