Lineage for d1pcqe2 (1pcq E:191-366)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389637Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 389744Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 389745Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 389746Protein GroEL, A domain [52031] (3 species)
  7. 389747Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 389826Domain d1pcqe2: 1pcq E:191-366 [94457]
    Other proteins in same PDB: d1pcqa1, d1pcqa3, d1pcqb1, d1pcqb3, d1pcqc1, d1pcqc3, d1pcqd1, d1pcqd3, d1pcqe1, d1pcqe3, d1pcqf1, d1pcqf3, d1pcqg1, d1pcqg3, d1pcqh1, d1pcqh3, d1pcqi1, d1pcqi3, d1pcqj1, d1pcqj3, d1pcqk1, d1pcqk3, d1pcql1, d1pcql3, d1pcqm1, d1pcqm3, d1pcqn1, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_

Details for d1pcqe2

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES

SCOP Domain Sequences for d1pcqe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqe2 c.8.5.1 (E:191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1pcqe2:

Click to download the PDB-style file with coordinates for d1pcqe2.
(The format of our PDB-style files is described here.)

Timeline for d1pcqe2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqa1, d1pcqa2, d1pcqa3, d1pcqb1, d1pcqb2, d1pcqb3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcqk1, d1pcqk2, d1pcqk3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_