Lineage for d1pcqb1 (1pcq B:2-136,B:410-525)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777516Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 777517Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 777518Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 777519Protein GroEL, E domain [48594] (4 species)
  7. 777520Species Escherichia coli [TaxId:562] [48595] (9 PDB entries)
  8. 777571Domain d1pcqb1: 1pcq B:2-136,B:410-525 [94447]
    Other proteins in same PDB: d1pcqa2, d1pcqa3, d1pcqb2, d1pcqb3, d1pcqc2, d1pcqc3, d1pcqd2, d1pcqd3, d1pcqe2, d1pcqe3, d1pcqf2, d1pcqf3, d1pcqg2, d1pcqg3, d1pcqh2, d1pcqh3, d1pcqi2, d1pcqi3, d1pcqj2, d1pcqj3, d1pcqk2, d1pcqk3, d1pcql2, d1pcql3, d1pcqm2, d1pcqm3, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_

Details for d1pcqb1

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES
PDB Compounds: (B:) groEL protein

SCOP Domain Sequences for d1pcqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqb1 a.129.1.1 (B:2-136,B:410-525) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOP Domain Coordinates for d1pcqb1:

Click to download the PDB-style file with coordinates for d1pcqb1.
(The format of our PDB-style files is described here.)

Timeline for d1pcqb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqa1, d1pcqa2, d1pcqa3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqe1, d1pcqe2, d1pcqe3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcqk1, d1pcqk2, d1pcqk3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_