![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins) |
![]() | Domain d1pcmx3: 1pcm X:259-367 [94442] Other proteins in same PDB: d1pcmx1, d1pcmx4 complexed with m6p, zn |
PDB Entry: 1pcm (more details), 1.9 Å
SCOPe Domain Sequences for d1pcmx3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pcmx3 c.84.1.1 (X:259-367) Phosphomannomutase/phosphoglucomutase, middle and C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} ypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmket gallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsaf
Timeline for d1pcmx3: