Lineage for d1pcmx3 (1pcm X:259-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910124Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)
  6. Protein Phosphomannomutase/phosphoglucomutase, middle and C-terminal domain [419009] (1 species)
  7. Species Pseudomonas aeruginosa [TaxId:287] [419481] (12 PDB entries)
  8. 2910192Domain d1pcmx3: 1pcm X:259-367 [94442]
    Other proteins in same PDB: d1pcmx1, d1pcmx4
    complexed with m6p, zn

Details for d1pcmx3

PDB Entry: 1pcm (more details), 1.9 Å

PDB Description: enzyme-ligand complex of p. aeruginosa pmm/pgm
PDB Compounds: (X:) Phosphomannomutase

SCOPe Domain Sequences for d1pcmx3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcmx3 c.84.1.1 (X:259-367) Phosphomannomutase/phosphoglucomutase, middle and C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
ypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmket
gallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsaf

SCOPe Domain Coordinates for d1pcmx3:

Click to download the PDB-style file with coordinates for d1pcmx3.
(The format of our PDB-style files is described here.)

Timeline for d1pcmx3: