Lineage for d1pcmx2 (1pcm X:155-258)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845112Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 845113Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 845114Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 845167Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)
  7. 845168Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries)
  8. 845182Domain d1pcmx2: 1pcm X:155-258 [94441]
    Other proteins in same PDB: d1pcmx4

Details for d1pcmx2

PDB Entry: 1pcm (more details), 1.9 Å

PDB Description: enzyme-ligand complex of p. aeruginosa pmm/pgm
PDB Compounds: (X:) Phosphomannomutase

SCOP Domain Sequences for d1pcmx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcmx2 c.84.1.1 (X:155-258) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
ilpryfkqirddiamakpmkvvvdcgngvagviapqliealgcsviplycevdgnfpnhh
pdpgkpenlkdliakvkaenadlglafdgdgdrvgvvtntgtii

SCOP Domain Coordinates for d1pcmx2:

Click to download the PDB-style file with coordinates for d1pcmx2.
(The format of our PDB-style files is described here.)

Timeline for d1pcmx2: