SCOP 1.75: Domain d1pcjx3: 1pcj X:259-367

Lineage for d1pcjx3 (1pcj X:259-367)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
   consists of three similar domains with 3 layers (a/b/a) each; duplication
   core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family)

5. Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)

6. Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries)

8. Domain d1pcjx3: 1pcj X:259-367 [94436]
   Other proteins in same PDB: d1pcjx4
   complexed with m1p, zn

Details for d1pcjx3

PDB Entry: 1pcj, 2 Å

PDB Description: enzyme-ligand complex of p. aeruginosa pmm/pgm

PDB Compounds: (X:) Phosphomannomutase

SCOP Domain Sequences for d1pcjx3:

Sequence; same for both SEQRES and ATOM records:

>d1pcjx3 c.84.1.1 (X:259-367) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
ypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmket
gallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsaf

Timeline for d1pcjx3:

• d1pcjx3 first appeared in SCOP 1.67
  
• d1pcjx3 appears in SCOP 1.73
  
• d1pcjx3 appears in SCOPe 2.01
  
• d1pcjx3 appears in the current release, SCOPe 2.08