Lineage for d1pc6a_ (1pc6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009132Fold d.262: NinB [103369] (1 superfamily)
    unusual fold; intertwined dimer; consists of two different structural domains
  4. 3009133Superfamily d.262.1: NinB [103370] (1 family) (S)
    automatically mapped to Pfam PF05772
  5. 3009134Family d.262.1.1: NinB [103371] (1 protein)
  6. 3009135Protein NinB [103372] (1 species)
  7. 3009136Species Bacteriophage lambda [TaxId:10710] [103373] (1 PDB entry)
  8. 3009137Domain d1pc6a_: 1pc6 A: [94430]
    complexed with bme

Details for d1pc6a_

PDB Entry: 1pc6 (more details), 2.51 Å

PDB Description: structural genomics, ninb
PDB Compounds: (A:) Protein ninB

SCOPe Domain Sequences for d1pc6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pc6a_ d.262.1.1 (A:) NinB {Bacteriophage lambda [TaxId: 10710]}
mkkltfeirspahqqnaihavqqilpdptkpivvtiqernrsldqnrklwaclgdvsrqv
ewhgrwldaeswkcvftaalkqqdvvpnlagngfvvigqstsrmrvgefaelleliqafg
tergvkwsdearlalewkarw

SCOPe Domain Coordinates for d1pc6a_:

Click to download the PDB-style file with coordinates for d1pc6a_.
(The format of our PDB-style files is described here.)

Timeline for d1pc6a_: