Lineage for d1pc5a_ (1pc5 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 411878Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 411896Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein)
    has C-terminal extension to the common fold
  6. 411897Protein Ferredoxin [54871] (3 species)
  7. 411898Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)
  8. 411908Domain d1pc5a_: 1pc5 A: [94429]
    complexed with f3s, fs4; mutant

Details for d1pc5a_

PDB Entry: 1pc5 (more details), 1.8 Å

PDB Description: crystal structure of the p50g mutant of ferredoxin i at 1.8 a resolution

SCOP Domain Sequences for d1pc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pc5a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii}
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecgaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

SCOP Domain Coordinates for d1pc5a_:

Click to download the PDB-style file with coordinates for d1pc5a_.
(The format of our PDB-style files is described here.)

Timeline for d1pc5a_: