Lineage for d1pc4a_ (1pc4 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2555964Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2555965Protein Ferredoxin [54871] (3 species)
  7. 2555966Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)
  8. 2555969Domain d1pc4a_: 1pc4 A: [94428]
    complexed with f3s, sf4; mutant

Details for d1pc4a_

PDB Entry: 1pc4 (more details), 1.65 Å

PDB Description: crystal structure of the p50a mutant of ferredoxin i at 1.65 a resolution
PDB Compounds: (A:) ferredoxin I

SCOPe Domain Sequences for d1pc4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pc4a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecaaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

SCOPe Domain Coordinates for d1pc4a_:

Click to download the PDB-style file with coordinates for d1pc4a_.
(The format of our PDB-style files is described here.)

Timeline for d1pc4a_: