Lineage for d1pc0a_ (1pc0 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 473128Fold b.137: RNase P subunit p29-like [101743] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 473129Superfamily b.137.1: RNase P subunit p29-like [101744] (1 family) (S)
  5. 473130Family b.137.1.1: RNase P subunit p29-like [101745] (2 proteins)
    two available NMR structures display similar topologies but different barrel shapes
  6. 473131Protein Hypothetical protein AF1917 [101746] (1 species)
  7. 473132Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101747] (1 PDB entry)
  8. 473133Domain d1pc0a_: 1pc0 A: [94426]

Details for d1pc0a_

PDB Entry: 1pc0 (more details)

PDB Description: NMR Structure of the Archaeal Homologue of RNase P Protein Rpp29

SCOP Domain Sequences for d1pc0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pc0a_ b.137.1.1 (A:) Hypothetical protein AF1917 {Archaeon Archaeoglobus fulgidus}
glmvevvespnhsevgikgevvdetqntlkimtekglkvvakrgrtfrvwykgkimrikg
d

SCOP Domain Coordinates for d1pc0a_:

Click to download the PDB-style file with coordinates for d1pc0a_.
(The format of our PDB-style files is described here.)

Timeline for d1pc0a_: