Lineage for d1pbyb_ (1pby B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379749Fold b.69: 7-bladed beta-propeller [50964] (12 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 379759Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families) (S)
  5. 379780Family b.69.2.2: Quinohemoprotein amine dehydrogenase B chain [69309] (1 protein)
    less regular propeller with imperfect sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    this is a repeat family; one repeat unit is 1jmx B:256-296 found in domain
  6. 379781Protein Quinohemoprotein amine dehydrogenase B chain [69310] (2 species)
  7. 379782Species Paracoccus denitrificans [TaxId:266] [69311] (2 PDB entries)
  8. 379783Domain d1pbyb_: 1pby B: [94422]
    Other proteins in same PDB: d1pbya1, d1pbya2, d1pbya3, d1pbya4, d1pbya5, d1pbyc_
    complexed with hem, tbu, trw

Details for d1pbyb_

PDB Entry: 1pby (more details), 1.7 Å

PDB Description: structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from paracoccus denitrificans at 1.7 a resolution

SCOP Domain Sequences for d1pbyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans}
rdyilaparpdklvvidtekmavdkvitiadagptpmvpmvapggriayatvnkseslvk
idlvtgetlgridlstpeervkslfgaalspdgktlaiyespvrlelthfevqptrvaly
daetlsrrkafeaprqitmlawardgsklyglgrdlhvmdpeagtlvedkpiqsweaety
aqpdvlavwnqhessgvmatpfytarkdidpadptayrtglltmdletgemamrevrimd
vfyfstavnpaktrafgaynvlesfdleknasikrvplphsyysvnvstdgstvwlggal
gdlaaydaetlekkgqvdlpgnasmslasvrlftrde

SCOP Domain Coordinates for d1pbyb_:

Click to download the PDB-style file with coordinates for d1pbyb_.
(The format of our PDB-style files is described here.)

Timeline for d1pbyb_: