Lineage for d1pbya1 (1pby A:1-85)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981391Family a.3.1.7: Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68956] (1 protein)
  6. 1981392Protein Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68957] (2 species)
    duplication: tandem repeat of two cytochrome c-like domains
  7. 1981393Species Paracoccus denitrificans [TaxId:266] [68958] (2 PDB entries)
  8. 1981394Domain d1pbya1: 1pby A:1-85 [94417]
    Other proteins in same PDB: d1pbya3, d1pbya4, d1pbya5, d1pbyb_, d1pbyc_
    complexed with hem, tbu

Details for d1pbya1

PDB Entry: 1pby (more details), 1.7 Å

PDB Description: structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from paracoccus denitrificans at 1.7 a resolution
PDB Compounds: (A:) quinohemoprotein amine dehydrogenase 60 kDa subunit

SCOPe Domain Sequences for d1pbya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbya1 a.3.1.7 (A:1-85) Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 {Paracoccus denitrificans [TaxId: 266]}
vtgeevlqnacaachvqhedgrweridaarktpegwdmtvtrmmrnhgvalepeeraaiv
rhlsdtrglslaeteerryilerep

SCOPe Domain Coordinates for d1pbya1:

Click to download the PDB-style file with coordinates for d1pbya1.
(The format of our PDB-style files is described here.)

Timeline for d1pbya1: