Lineage for d1pbta_ (1pbt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922307Family c.124.1.1: NagB-like [52513] (3 proteins)
    share a common phosphate-binding site with the RpiA family
  6. 2922308Protein 6-phosphogluconolactonase [102321] (1 species)
  7. 2922309Species Thermotoga maritima [TaxId:2336] [102322] (2 PDB entries)
    Uniprot Q9X0N8 # TM1154
  8. 2922311Domain d1pbta_: 1pbt A: [94416]
    structural genomics
    complexed with edo, fmt, so4, trs

Details for d1pbta_

PDB Entry: 1pbt (more details), 1.7 Å

PDB Description: The crystal structure of TM1154, oxidoreductase, sol/devB family from Thermotoga maritima
PDB Compounds: (A:) 6-phosphogluconolactonase

SCOPe Domain Sequences for d1pbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbta_ c.124.1.1 (A:) 6-phosphogluconolactonase {Thermotoga maritima [TaxId: 2336]}
mektviylledgyvdfvvekirtkmeklleekdkifvvlaggrtplpvyeklaeqkfpwn
rihfflsderyvpldsdqsnfrninevlfsrakipsgnvhyvdtslpiekacekyereir
satdqfdlailgmgpdghvasifdletgnkdnlvtftdpsgdpkvprvtltfralntsly
vlflirgkekinrlteilkdtplpayfvrgkektvwfvgk

SCOPe Domain Coordinates for d1pbta_:

Click to download the PDB-style file with coordinates for d1pbta_.
(The format of our PDB-style files is described here.)

Timeline for d1pbta_: