SCOPe 2.08: Domain d1paqa_: 1paq A:

Lineage for d1paqa_ (1paq A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein Translation initiation factor eIF-2b epsilon [101403] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101404] (1 PDB entry)

8. Domain d1paqa_: 1paq A: [94413]
   C-terminal domain
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1paqa_

PDB Entry: 1paq, 2.3 Å

PDB Description: crystal structure of the catalytic fragment of eukaryotic initiation factor 2b epsilon

PDB Compounds: (A:) Translation initiation factor eIF-2B epsilon subunit

SCOPe Domain Sequences for d1paqa_:

Sequence; same for both SEQRES and ATOM records:

>d1paqa_ a.118.1.14 (A:) Translation initiation factor eIF-2b epsilon {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfekegiatveramennhdldtallelntlrmsmnvtyhevriatitallrrvyhfiatq
tlgpkdavvkvfnqwgllfkrqafdeeeyidlmniimekiveqsfdkpdlilfsalvsly
dndiieedviykwwdnvstdprydevkkltvkwvewlqnad

Timeline for d1paqa_:

• d1paqa_ first appeared in SCOP 1.67
  
• d1paqa_ appears in SCOPe 2.07