Lineage for d1paex_ (1pae X:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412241Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) (S)
  5. 412242Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)
  6. 412243Protein Nucleoside diphosphate kinases [54921] (9 species)
  7. 412256Species Dictyostelium discoideum [TaxId:44689] [54925] (21 PDB entries)
  8. 412296Domain d1paex_: 1pae X: [94412]
    complexed with cse, se; mutant

Details for d1paex_

PDB Entry: 1pae (more details), 2.7 Å

PDB Description: nucleoside diphosphate kinase

SCOP Domain Sequences for d1paex_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1paex_ d.58.6.1 (X:) Nucleoside diphosphate kinases {Dictyostelium discoideum}
kertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpffgg
lvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniicgsdsv
esanreialwfkpeelltevkpnpnlye

SCOP Domain Coordinates for d1paex_:

Click to download the PDB-style file with coordinates for d1paex_.
(The format of our PDB-style files is described here.)

Timeline for d1paex_: