Lineage for d1pa9a_ (1pa9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116365Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 protein domains)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2116370Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species)
  7. 2116375Species Yersinia enterocolitica [TaxId:630] [52812] (19 PDB entries)
  8. 2116386Domain d1pa9a_: 1pa9 A: [94411]
    complexed with csn; mutant

Details for d1pa9a_

PDB Entry: 1pa9 (more details), 2 Å

PDB Description: Yersinia Protein-Tyrosine Phosphatase complexed with pNCS (Yop51,Pasteurella X,Ptpase,Yop51delta162) (Catalytic Domain, Residues 163-468) Mutant With Cys 235 Replaced By Arg (C235r)
PDB Compounds: (A:) protein-tyrosine phosphatase yoph

SCOPe Domain Sequences for d1pa9a_:

Sequence, based on SEQRES records: (download)

>d1pa9a_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
kalaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrns
qlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

Sequence, based on observed residues (ATOM records): (download)

>d1pa9a_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
kalaslvdqtaetkrnmyeskgsddsklrpvihcragvgrtaqligamcmndsrnsqlsv
edmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOPe Domain Coordinates for d1pa9a_:

Click to download the PDB-style file with coordinates for d1pa9a_.
(The format of our PDB-style files is described here.)

Timeline for d1pa9a_: