Lineage for d1pa7a_ (1pa7 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355790Fold a.40: CH domain-like [47575] (2 superfamilies)
    core: 4 helices: bundle
  4. 355791Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 355792Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (8 proteins)
  6. 355814Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (1 species)
    member of rp/eb family
  7. 355815Species Human (Homo sapiens) [TaxId:9606] [101195] (2 PDB entries)
  8. 355816Domain d1pa7a_: 1pa7 A: [94410]
    complexed with so4

Details for d1pa7a_

PDB Entry: 1pa7 (more details), 1.45 Å

PDB Description: Crystal structure of amino-terminal microtubule binding domain of EB1

SCOP Domain Sequences for d1pa7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pa7a_ a.40.1.1 (A:) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens)}
mavnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkk
vkfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanyd
gkdydpvaar

SCOP Domain Coordinates for d1pa7a_:

Click to download the PDB-style file with coordinates for d1pa7a_.
(The format of our PDB-style files is described here.)

Timeline for d1pa7a_: