SCOPe 2.08: Domain d1pa3a2: 1pa3 A:5-85

Lineage for d1pa3a2 (1pa3 A:5-85)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Pf GST [102442] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102443] (6 PDB entries)

8. Domain d1pa3a2: 1pa3 A:5-85 [94406]
   Other proteins in same PDB: d1pa3a1, d1pa3b1

Details for d1pa3a2

PDB Entry: 1pa3, 2.7 Å

PDB Description: Crystal Structure of Glutathione-S-transferase from Plasmodium falciparum

PDB Compounds: (A:) Glutathione s-transferase, putative

SCOPe Domain Sequences for d1pa3a2:

Sequence; same for both SEQRES and ATOM records:

>d1pa3a2 c.47.1.5 (A:5-85) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpilqi
gdlilaqsqaivrylskkyni

Timeline for d1pa3a2:

• d1pa3a2 first appeared in SCOP 1.67
  
• d1pa3a2 appears in SCOPe 2.07