Lineage for d1pa3a2 (1pa3 A:5-85)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877253Protein Pf GST [102442] (1 species)
    cannot be assigned to any of the known GST classes
  7. 2877254Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102443] (6 PDB entries)
  8. 2877265Domain d1pa3a2: 1pa3 A:5-85 [94406]
    Other proteins in same PDB: d1pa3a1, d1pa3b1

Details for d1pa3a2

PDB Entry: 1pa3 (more details), 2.7 Å

PDB Description: Crystal Structure of Glutathione-S-transferase from Plasmodium falciparum
PDB Compounds: (A:) Glutathione s-transferase, putative

SCOPe Domain Sequences for d1pa3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pa3a2 c.47.1.5 (A:5-85) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpilqi
gdlilaqsqaivrylskkyni

SCOPe Domain Coordinates for d1pa3a2:

Click to download the PDB-style file with coordinates for d1pa3a2.
(The format of our PDB-style files is described here.)

Timeline for d1pa3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pa3a1