SCOP 1.73: Domain d1pa3a1: 1pa3 A:86-206

Lineage for d1pa3a1 (1pa3 A:86-206)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Pf GST [101210] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [101211] (4 PDB entries)

8. Domain d1pa3a1: 1pa3 A:86-206 [94405]
   Other proteins in same PDB: d1pa3a2, d1pa3b2

Details for d1pa3a1

PDB Entry: 1pa3, 2.7 Å

PDB Description: Crystal Structure of Glutathione-S-transferase from Plasmodium falciparum

PDB Compounds: (A:) Glutathione s-transferase, putative

SCOP Domain Sequences for d1pa3a1:

Sequence, based on SEQRES records:

>d1pa3a1 a.45.1.1 (A:86-206) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
r

Sequence, based on observed residues (ATOM records):

>d1pa3a1 a.45.1.1 (A:86-206) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhky
yfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnr

Timeline for d1pa3a1:

• d1pa3a1 first appeared in SCOP 1.67
  
• d1pa3a1 appears in SCOP 1.71
  
• d1pa3a1 appears in SCOP 1.75
  
• d1pa3a1 appears in the current release, SCOPe 2.08