Lineage for d1pa3a1 (1pa3 A:86-206)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 protein domains)
  6. 356347Protein Pf GST [101210] (1 species)
    cannot be assigned to any of the known GST classes
  7. 356348Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [101211] (3 PDB entries)
  8. 356353Domain d1pa3a1: 1pa3 A:86-206 [94405]
    Other proteins in same PDB: d1pa3a2, d1pa3b2

Details for d1pa3a1

PDB Entry: 1pa3 (more details), 2.7 Å

PDB Description: Crystal Structure of Glutathione-S-transferase from Plasmodium falciparum

SCOP Domain Sequences for d1pa3a1:

Sequence, based on SEQRES records: (download)

>d1pa3a1 a.45.1.1 (A:86-206) Pf GST {Malarial parasite (Plasmodium falciparum)}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
r

Sequence, based on observed residues (ATOM records): (download)

>d1pa3a1 a.45.1.1 (A:86-206) Pf GST {Malarial parasite (Plasmodium falciparum)}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhky
yfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnr

SCOP Domain Coordinates for d1pa3a1:

Click to download the PDB-style file with coordinates for d1pa3a1.
(The format of our PDB-style files is described here.)

Timeline for d1pa3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pa3a2