Lineage for d1p9wa1 (1p9w A:98-498)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112473Protein Extracellular secretion NTPase EpsE [102375] (1 species)
    type II/IV secretion system protein; overall structure is similar to HP0525
  7. 2112474Species Vibrio cholerae [TaxId:666] [102376] (2 PDB entries)
  8. 2112476Domain d1p9wa1: 1p9w A:98-498 [94400]
    Other proteins in same PDB: d1p9wa2
    complexed with anp, zn

Details for d1p9wa1

PDB Entry: 1p9w (more details), 2.7 Å

PDB Description: Crystal Structure of Vibrio cholerae putative NTPase EpsE
PDB Compounds: (A:) General secretion pathway protein E

SCOPe Domain Sequences for d1p9wa1:

Sequence, based on SEQRES records: (download)

>d1p9wa1 c.37.1.11 (A:98-498) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}
sddffslaeelpqnedlleseddapiiklinamlgeaikegasdihietfektlsirfrv
dgvlrevlapsrklssllvsrvkvmakldiaekrvpqdgrislriggravdvrvstmpss
hgervvmrlldknatrldlhslgmtahnhdnfrrlikrphgiilvtgptgsgksttlyag
lqelnsserniltvedpiefdidgigqtqvnprvdmtfarglrailrqdpdvvmvgeird
letaqiavqasltghlvmstlhtntavgavtrlrdmgiepflisssllgvlaqrlvrtlc
pdckepyeadkeqrklfdskkkeplilyratgcpkcnhkgyrgrtgihelllvddalqel
ihseageqamekhirattpsirddgldkvrqgitsleevmr

Sequence, based on observed residues (ATOM records): (download)

>d1p9wa1 c.37.1.11 (A:98-498) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}
sddffslaeelapiiklinamlgeaikegasdihietfektlsirfrvdgvlrevlapsr
klssllvsrvkvmakldiaekrvpqdgrislrigavdvrvstmpsshgervvmrlldkna
trldlhslgmtahnhdnfrrlikrphgiilvtgptgsgksttlyaglqelnsserniltv
edpiefdidgigqtqvnprvdmtfarglrailrqdpdvvmvgeirdletaqiavqasltg
hlvmstlhtntavgavtrlrdmgiepflisssllgvlaqrlvrtlcpdckepyeadkeqr
klfeplilyratgcpkcnhkgyrgrtgihelllvddalqelihseageqamekhirattp
sirddgldkvrqgitsleevmr

SCOPe Domain Coordinates for d1p9wa1:

Click to download the PDB-style file with coordinates for d1p9wa1.
(The format of our PDB-style files is described here.)

Timeline for d1p9wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p9wa2