Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.3: Phosphopantothenoylcysteine synthetase [102645] (1 family) combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest |
Family c.72.3.1: Phosphopantothenoylcysteine synthetase [102646] (1 protein) |
Protein Phosphopantothenoylcysteine synthetase [102647] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102648] (1 PDB entry) |
Domain d1p9ob_: 1p9o B: [94398] complexed with so4 |
PDB Entry: 1p9o (more details), 2.3 Å
SCOP Domain Sequences for d1p9ob_:
Sequence, based on SEQRES records: (download)
>d1p9ob_ c.72.3.1 (B:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens)} vaefpqppgaarwaevmarfaarlgaqgrrvvlvtsggtkvplearpvrfldnfssgrrg atsaeaflaagygvlflyrarsafpyahrfppqtwlsalrpsgpalsgllsleaeenalp gfaealrsyqeaaaagtflvvefttladylhllqaaaqalnplgpsamfylaaavsdfyv pvsempehkiessggplqitmkmvpkllsplvkdwapkafiisfkletdpaivinrarka leiyqhqvvvanilesrqsfvlivtkdsetklllseeeiekgveieekivdnlqsrhtaf i
>d1p9ob_ c.72.3.1 (B:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens)} vaefpqppgaarwaevmarfaarlgaqgrrvvlvtsggtkvplearpvrfldnfssgrrg atsaeaflaagygvlflyrarsafpyahrfppqtwlsalrpsgllsleaeenalpgfaea lrsyqeaaaagtflvvefttladylhllqaaaqalnplgpsamfylaaavsdfyvpvsem lqitmkmvpkllsplvkdwapkafiisfkletdpaivinrarkaleiyqhqvvvanisfv livtkdsetklllseeeiekgveieekivdnlqsrhtafi
Timeline for d1p9ob_: