Lineage for d1p9oa_ (1p9o A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2138039Superfamily c.72.3: CoaB-like [102645] (2 families) (S)
    combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest
  5. 2138040Family c.72.3.1: CoaB-like [102646] (2 protein domains)
    Pfam PF04127
  6. 2138053Protein Phosphopantothenoylcysteine synthetase [102647] (1 species)
  7. 2138054Species Human (Homo sapiens) [TaxId:9606] [102648] (1 PDB entry)
  8. 2138055Domain d1p9oa_: 1p9o A: [94397]
    complexed with so4

Details for d1p9oa_

PDB Entry: 1p9o (more details), 2.3 Å

PDB Description: Crystal Structure of Phosphopantothenoylcysteine Synthetase
PDB Compounds: (A:) Phosphopantothenoylcysteine synthetase

SCOPe Domain Sequences for d1p9oa_:

Sequence, based on SEQRES records: (download)

>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]}
rwaevmarfaarlgaqgrrvvlvtsggtkvplearpvrfldnfssgrrgatsaeaflaag
ygvlflyrarsafpyahrfppqtwlsalrpsgpalsgllsleaeenalpgfaealrsyqe
aaaagtflvvefttladylhllqaaaqalnplgpsamfylaaavsdfyvpvsempehkie
ssggplqitmkmvpkllsplvkdwapkafiisfkletdpaivinrarkaleiyqhqvvva
nilesrqsfvlivtkdsetklllseeeiekgveieekivdnlqsrhtafi

Sequence, based on observed residues (ATOM records): (download)

>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]}
rwaevmarfaarlgaqgrrvvlvtsggtkvplearpvrfldnfssgrrgatsaeaflaag
ygvlflyrarsafpyahrfppqtwlsalrpsgplsgllsleaeenalpgfaealrsyqea
aaagtflvvefttladylhllqaaaqalnplgpsamfylaaavsdfyvpplqitmkmvpk
llsplvkdwapkafiisfkletdpaivinrarkaleiyqhqvvvanifvlivtkdsetkl
llseeeiekgveieekivdnlqsrhtafi

SCOPe Domain Coordinates for d1p9oa_:

Click to download the PDB-style file with coordinates for d1p9oa_.
(The format of our PDB-style files is described here.)

Timeline for d1p9oa_: