SCOPe 2.06: Domain d1p9lb1: 1p9l B:1-105,B:215-245

Lineage for d1p9lb1 (1p9l B:1-105,B:215-245)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Dihydrodipicolinate reductase [51821] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [102160] (5 PDB entries)

8. Domain d1p9lb1: 1p9l B:1-105,B:215-245 [94395]
   Other proteins in same PDB: d1p9la2, d1p9lb2
   complexed with nai, pdc, pg4

Details for d1p9lb1

PDB Entry: 1p9l, 2.3 Å

PDB Description: Structure of M. tuberculosis dihydrodipicolinate reductase in complex with NADH and 2,6 PDC

PDB Compounds: (B:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1p9lb1:

Sequence; same for both SEQRES and ATOM records:

>d1p9lb1 c.2.1.3 (B:1-105,B:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}
mrvgvlgakgkvgttmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrri
aerpgltvgleplldlh

Timeline for d1p9lb1:

• d1p9lb1 first appeared in SCOP 1.67
  
• d1p9lb1 appears in SCOPe 2.05
  
• d1p9lb1 appears in SCOPe 2.07
  
• d1p9lb1 appears in the current release, SCOPe 2.08