![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Dihydrodipicolinate reductase [51821] (3 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [102160] (2 PDB entries) |
![]() | Domain d1p9la1: 1p9l A:1-105,A:215-245 [94393] Other proteins in same PDB: d1p9la2, d1p9lb2 |
PDB Entry: 1p9l (more details), 2.3 Å
SCOP Domain Sequences for d1p9la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9la1 c.2.1.3 (A:1-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis} mrvgvlgakgkvgttmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrri aerpgltvgleplldlh
Timeline for d1p9la1: