SCOPe 2.07: Domain d1p9ka1: 1p9k A:3-79

Lineage for d1p9ka1 (1p9k A:3-79)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.6: YbcJ-like [103046] (1 protein)
   overall topological similarity to the TyrRS C-domain
   automatically mapped to Pfam PF13275

6. Protein Hypothetical protein YbcJ [103047] (1 species)

7. Species Escherichia coli [TaxId:562] [103048] (1 PDB entry)

8. Domain d1p9ka1: 1p9k A:3-79 [94392]
   Other proteins in same PDB: d1p9ka2

Details for d1p9ka1

PDB Entry: 1p9k

PDB Description: the solution structure of ybcj from e. coli reveals a recently discovered alfal motif involved in rna-binding

PDB Compounds: (A:) orf, hypothetical protein

SCOPe Domain Sequences for d1p9ka1:

Sequence; same for both SEQRES and ATOM records:

>d1p9ka1 d.66.1.6 (A:3-79) Hypothetical protein YbcJ {Escherichia coli [TaxId: 562]}
mihrmsnmatfslgkhphvelcdllklegwsesgaqakiaiaegqvkvdgavetrkrcki
vagqtvsfaghsvqvva

Timeline for d1p9ka1:

• d1p9ka1 first appeared in SCOP 1.67, called d1p9ka_
  
• d1p9ka1 appears in SCOPe 2.06
  
• d1p9ka1 appears in the current release, SCOPe 2.08