Lineage for d1p9ka1 (1p9k A:3-79)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956861Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2956862Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2956969Family d.66.1.6: YbcJ-like [103046] (1 protein)
    overall topological similarity to the TyrRS C-domain
    automatically mapped to Pfam PF13275
  6. 2956970Protein Hypothetical protein YbcJ [103047] (1 species)
  7. 2956971Species Escherichia coli [TaxId:562] [103048] (1 PDB entry)
  8. 2956972Domain d1p9ka1: 1p9k A:3-79 [94392]
    Other proteins in same PDB: d1p9ka2

Details for d1p9ka1

PDB Entry: 1p9k (more details)

PDB Description: the solution structure of ybcj from e. coli reveals a recently discovered alfal motif involved in rna-binding
PDB Compounds: (A:) orf, hypothetical protein

SCOPe Domain Sequences for d1p9ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9ka1 d.66.1.6 (A:3-79) Hypothetical protein YbcJ {Escherichia coli [TaxId: 562]}
mihrmsnmatfslgkhphvelcdllklegwsesgaqakiaiaegqvkvdgavetrkrcki
vagqtvsfaghsvqvva

SCOPe Domain Coordinates for d1p9ka1:

Click to download the PDB-style file with coordinates for d1p9ka1.
(The format of our PDB-style files is described here.)

Timeline for d1p9ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p9ka2