| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
| Family d.66.1.6: YbcJ-like [103046] (1 protein) overall topological similarity to the TyrRS C-domain automatically mapped to Pfam PF13275 |
| Protein Hypothetical protein YbcJ [103047] (1 species) |
| Species Escherichia coli [TaxId:562] [103048] (1 PDB entry) |
| Domain d1p9ka1: 1p9k A:3-79 [94392] Other proteins in same PDB: d1p9ka2 |
PDB Entry: 1p9k (more details)
SCOPe Domain Sequences for d1p9ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9ka1 d.66.1.6 (A:3-79) Hypothetical protein YbcJ {Escherichia coli [TaxId: 562]}
mihrmsnmatfslgkhphvelcdllklegwsesgaqakiaiaegqvkvdgavetrkrcki
vagqtvsfaghsvqvva
Timeline for d1p9ka1: