Lineage for d1p9ba_ (1p9b A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126015Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2126016Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. 2126046Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102372] (1 PDB entry)
  8. 2126047Domain d1p9ba_: 1p9b A: [94385]
    complexed with gdp, hda, imo, mg, no3

Details for d1p9ba_

PDB Entry: 1p9b (more details), 2 Å

PDB Description: Structure of fully ligated Adenylosuccinate synthetase from Plasmodium falciparum
PDB Compounds: (A:) adenylosuccinate synthetase

SCOPe Domain Sequences for d1p9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9ba_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gnvvailgaqwgdegkgkiidmlseysditcrfngganaghtisvndkkyalhllpcgvl
ydnnisvlgngmvihvkslmeeiesvggklldrlylsnkahilfdihqiidsiqetkklk
egkqigttkrgigpcystkasrigirlgtlknfenfknmysklidhlmdlyniteydkek
elnlfynyhiklrdrivdvisfmntnlennkkvlieganaamldidfgtypyvtsscttv
ggvfsglgihhkklnlvvgvvksyltrvgcgpfltelnndvgqylrekgheygtttkrpr
rcgwldipmllyvkcinsidminltkldvlsgleeillcvnfknkktgellekgcypvee
eiseeyepvyekfsgwkedistcnefdelpenakkyilaiekylktpivwigvgpnrknm
ivkk

SCOPe Domain Coordinates for d1p9ba_:

Click to download the PDB-style file with coordinates for d1p9ba_.
(The format of our PDB-style files is described here.)

Timeline for d1p9ba_: