Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) |
Protein Putative lipoprotein (NlpA family) [102700] (2 species) aka PG110, TpN32 |
Species Staphylococcus aureus [TaxId:1280] [102701] (1 PDB entry) |
Domain d1p99a_: 1p99 A: [94384] structural genomics complexed with gly, met |
PDB Entry: 1p99 (more details), 1.7 Å
SCOP Domain Sequences for d1p99a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p99a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Staphylococcus aureus [TaxId: 1280]} kvtigvasndtkawekvkelakkddidveikhfsdynlpnkalndgdidmnafqhfafld qykkahkgtkisalsttvlaplgiysdkikdvkkvkdgakvvipndvsnqaralklleaa gliklkkdfglagtvkditsnpkhlkitavdaqqtaralsdvdiavinngvatkagkdpk ndpifleksnsdavkpyinivavndkdldnktyakivelyhskeaqkalqedvkdgekpv nlskdeikaietsla
Timeline for d1p99a_: