SCOP 1.75: Domain d1p99a_: 1p99 A:

Lineage for d1p99a_ (1p99 A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Putative lipoprotein (NlpA family) [102700] (2 species)
   aka PG110, TpN32

7. Species Staphylococcus aureus [TaxId:1280] [102701] (1 PDB entry)

8. Domain d1p99a_: 1p99 A: [94384]
   structural genomics
   complexed with gly, met

Details for d1p99a_

PDB Entry: 1p99, 1.7 Å

PDB Description: 1.7a crystal structure of protein pg110 from staphylococcus aureus

PDB Compounds: (A:) Hypothetical protein PG110

SCOP Domain Sequences for d1p99a_:

Sequence; same for both SEQRES and ATOM records:

>d1p99a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Staphylococcus aureus [TaxId: 1280]}
kvtigvasndtkawekvkelakkddidveikhfsdynlpnkalndgdidmnafqhfafld
qykkahkgtkisalsttvlaplgiysdkikdvkkvkdgakvvipndvsnqaralklleaa
gliklkkdfglagtvkditsnpkhlkitavdaqqtaralsdvdiavinngvatkagkdpk
ndpifleksnsdavkpyinivavndkdldnktyakivelyhskeaqkalqedvkdgekpv
nlskdeikaietsla

Timeline for d1p99a_:

• d1p99a_ first appeared in SCOP 1.67
  
• d1p99a_ appears in SCOP 1.73
  
• d1p99a_ appears in SCOPe 2.01
  
• d1p99a_ appears in the current release, SCOPe 2.08