Lineage for d1p98a_ (1p98 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598489Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 598490Family d.15.1.1: Ubiquitin-related [54237] (26 proteins)
    Pfam 00240
  6. 598600Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species)
  7. 598601Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries)
  8. 598602Domain d1p98a_: 1p98 A: [94383]

Details for d1p98a_

PDB Entry: 1p98 (more details)

PDB Description: high-resolution nmr structure of the ubl-domain of hhr23a

SCOP Domain Sequences for d1p98a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p98a_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens)}
mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
irdyrideknfvvvmvtk

SCOP Domain Coordinates for d1p98a_:

Click to download the PDB-style file with coordinates for d1p98a_.
(The format of our PDB-style files is described here.)

Timeline for d1p98a_: