| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins) contains PAC motif |
| Protein Hypoxia-inducible factor Hif2a, C-terminal domain [103185] (1 species) endothelial pas domain protein 1, EPAS-1 |
| Species Human (Homo sapiens) [TaxId:9606] [103186] (1 PDB entry) |
| Domain d1p97a_: 1p97 A: [94382] |
PDB Entry: 1p97 (more details)
SCOPe Domain Sequences for d1p97a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gamdsktflsrhsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnl
ctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiekn
Timeline for d1p97a_: