Lineage for d1p97a_ (1p97 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417123Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 417184Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 417256Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (1 protein)
    contains PAC motif
  6. 417257Protein Hypoxia-inducible factor Hif2a, C-terminal domain [103185] (1 species)
    endothelial pas domain protein 1, EPAS-1
  7. 417258Species Human (Homo sapiens) [TaxId:9606] [103186] (1 PDB entry)
  8. 417259Domain d1p97a_: 1p97 A: [94382]

Details for d1p97a_

PDB Entry: 1p97 (more details)

PDB Description: nmr structure of the c-terminal pas domain of hif2a

SCOP Domain Sequences for d1p97a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens)}
gamdsktflsrhsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnl
ctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiekn

SCOP Domain Coordinates for d1p97a_:

Click to download the PDB-style file with coordinates for d1p97a_.
(The format of our PDB-style files is described here.)

Timeline for d1p97a_: