Lineage for d1p97a1 (1p97 A:4-114)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2534777Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2534960Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
    contains PAC motif
  6. 2534961Protein Hypoxia-inducible factor Hif2a, C-terminal domain [103185] (1 species)
    endothelial pas domain protein 1, EPAS-1
  7. 2534962Species Human (Homo sapiens) [TaxId:9606] [103186] (1 PDB entry)
  8. 2534963Domain d1p97a1: 1p97 A:4-114 [94382]
    Other proteins in same PDB: d1p97a2

Details for d1p97a1

PDB Entry: 1p97 (more details)

PDB Description: NMR structure of the C-terminal PAS domain of HIF2a
PDB Compounds: (A:) Endothelial PAS domain protein 1

SCOPe Domain Sequences for d1p97a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p97a1 d.110.3.7 (A:4-114) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dsktflsrhsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlctk
gqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiekn

SCOPe Domain Coordinates for d1p97a1:

Click to download the PDB-style file with coordinates for d1p97a1.
(The format of our PDB-style files is described here.)

Timeline for d1p97a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p97a2