SCOP 1.73: Domain d1p94b_: 1p94 B:

Lineage for d1p94b_ (1p94 B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (8 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.3: CopG-like [100970] (3 proteins)
   similar to the phage repressor family

6. Protein Plasmid partition protein ParG [101203] (1 species)

7. Species Salmonella enterica [TaxId:28901] [101204] (1 PDB entry)

8. Domain d1p94b_: 1p94 B: [94381]

Details for d1p94b_

PDB Entry: 1p94

PDB Description: nmr structure of parg symmetric dimer

PDB Compounds: (B:) plasmid partition protein ParG

SCOP Domain Sequences for d1p94b_:

Sequence; same for both SEQRES and ATOM records:

>d1p94b_ a.43.1.3 (B:) Plasmid partition protein ParG {Salmonella enterica [TaxId: 28901]}
mslekahtsvkkmtfgenrdlervvtapvssgkikrvnvnfdeekhtrfkaacarkgtsi
tdvvnqlvdnwlkene

Timeline for d1p94b_:

• d1p94b_ first appeared in SCOP 1.67
  
• d1p94b_ appears in SCOP 1.71
  
• d1p94b_ appears in SCOP 1.75
  
• d1p94b_ appears in the current release, SCOPe 2.08