![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.3: CopG-like [100970] (4 proteins) similar to the phage repressor family |
![]() | Protein Plasmid partition protein ParG [101203] (1 species) |
![]() | Species Salmonella enterica [TaxId:28901] [101204] (1 PDB entry) |
![]() | Domain d1p94a_: 1p94 A: [94380] |
PDB Entry: 1p94 (more details)
SCOPe Domain Sequences for d1p94a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p94a_ a.43.1.3 (A:) Plasmid partition protein ParG {Salmonella enterica [TaxId: 28901]} mslekahtsvkkmtfgenrdlervvtapvssgkikrvnvnfdeekhtrfkaacarkgtsi tdvvnqlvdnwlkene
Timeline for d1p94a_: