Lineage for d1p91b_ (1p91 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130183Family c.66.1.33: rRNA methyltransferase RlmA [102557] (1 protein)
  6. 2130184Protein rRNA methyltransferase RlmA [102558] (1 species)
    23S rRNA N1-G745 methyltransferase
  7. 2130185Species Escherichia coli [TaxId:562] [102559] (1 PDB entry)
  8. 2130187Domain d1p91b_: 1p91 B: [94379]
    structural genomics; NESG target ER19
    complexed with sam, so4, zn

Details for d1p91b_

PDB Entry: 1p91 (more details), 2.8 Å

PDB Description: crystal structure of rlma(i) enzyme: 23s rrna n1-g745 methyltransferase (northeast structural genomics consortium target er19)
PDB Compounds: (B:) Ribosomal RNA large subunit methyltransferase A

SCOPe Domain Sequences for d1p91b_:

Sequence, based on SEQRES records: (download)

>d1p91b_ c.66.1.33 (B:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}
sfscplchqplsreknsyicpqrhqfdmakegyvnllpvqhkrsrdpgdsaemmqarraf
ldaghyqplrdaivaqlrerlddkatavldigcgegyythafadalpeittfgldvskva
ikaaakrypqvtfcvasshrlpfsdtsmdaiiriyapckaeelarvvkpggwvitatpgp
rhlmelkgliynevhlhaphaeqlegftlqqsaelcypmrlrgdeavallqmtpfawrak
pevwqtlaakevfdcqtdfnihlwqrsy

Sequence, based on observed residues (ATOM records): (download)

>d1p91b_ c.66.1.33 (B:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}
sfscplchqplsreknsyicpqrhqfdmakegyvnllpdsaemmqarrafldaghyqplr
daivaqlrerlddkatavldigcgegyythafadalpeittfgldvskvaikaaakrypq
vtfcvasshrlpfsdtsmdaiiriyapckaeelarvvkpggwvitatpgprhlmelkgli
ynevhlhaphaeqlegftlqqsaelcypmrlrgdeavallqmtpfawrakpevwqtlaak
evfdcqtdfnihlwqrsy

SCOPe Domain Coordinates for d1p91b_:

Click to download the PDB-style file with coordinates for d1p91b_.
(The format of our PDB-style files is described here.)

Timeline for d1p91b_: