Lineage for d1p8xa2 (1p8x A:533-628)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427557Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1427558Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1427559Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1427560Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1427577Species Human (Homo sapiens) [TaxId:9606] [55761] (30 PDB entries)
    Uniprot P20065 55-179
  8. 1427597Domain d1p8xa2: 1p8x A:533-628 [94366]
    domains 4, 5 and 6
    complexed with ca

Details for d1p8xa2

PDB Entry: 1p8x (more details), 2 Å

PDB Description: The Calcium-Activated C-terminal half of gelsolin
PDB Compounds: (A:) Gelsolin precursor, plasma

SCOPe Domain Sequences for d1p8xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8xa2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq
ellrvlraqpvqvaegsepdgfwealggkaayrtsp

SCOPe Domain Coordinates for d1p8xa2:

Click to download the PDB-style file with coordinates for d1p8xa2.
(The format of our PDB-style files is described here.)

Timeline for d1p8xa2: